Protein coding transcript 1640

• Transcript: Ll_transcript_510838
• CDS coordinates: 75-512 (+)
• Peptide sequence: MSMIPCIFGTGRSINFGRNPFTTTTTTNDTSTITNAHINWTETPEAHIFKVDLPGLKNGDVKVDMLAGRVLQISGDWNKEKKEKEKNDTVRRLERSGGNFVRRFRLPENAKVEKVKACMENGVLTITVPKEEVKKPYLKLVQIKG*
• ORF Type: complete

Annotations of Ll_transcript_510838

• Blastp: 17.5 kDa class I heat shock protein from Soja with 55.41% of identity
• Blastx: 17.5 kDa class I heat shock protein from Soja with 56.13% of identity
• Eggnog: response to heat(COG0071)
• Kegg: Link to kegg annotations (100791172)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455843.1)
• Pfam: Hsp20/alpha crystallin family (PF00011.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;