Protein coding transcript 164002

• Transcript: Ll_transcript_244974
• CDS coordinates: 1050-1397 (+)
• Peptide sequence: MLQQHPSPNKSRKDALKNEILQRIKPWIKRELEAVLGDPDPTVIVHVVTSQFIAWLEEKARMPSGQCDVGNDFIHPLRPFLHDKASTFWHELSCFGESCYNMETYDAVVQYRHLE*
• ORF Type: complete

Annotations of Ll_transcript_244974

• Blastp: E3 ubiquitin-protein ligase Topors from Homo with 30.85% of identity
• Blastx: E3 ubiquitin-protein ligase Topors from Mus with 37.31% of identity
• Eggnog: topoisomerase I binding, arginine serine-rich, E3 ubiquitin protein ligase(ENOG410XQZR)
• Kegg: Link to kegg annotations (10210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437675.1)
• Pfam: PWI domain (PF01480.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;