Protein coding transcript 164007

• Transcript: Ll_transcript_244971
• CDS coordinates: 130-1005 (+)
• Peptide sequence: MMERRKREKEKENDLVWNSIRGRNCPICLTHLQPRYNEVAVLTRCYHAYCTQCIARWSQLRRICPLCNSLFNSWFSILNLSFRKHFLPPLHASQPRLPITTRRIVGRRIRRVDRRALQWRRSFGNPASVTALVIAQRKLEWRASIYNNIGLQPDPTTLRCLEARCNGCSPCKLFLSMLQQHPSPNKSRKDALKNEILQRIKPWIKRELEAVLGDPDPTVIVHVVTSQFIAWLEEKARMPSGQCDVGNDFIHPLRPFLHDKASTFWHELSCFGESCYNMETYDAVVQYRHLE*
• ORF Type: complete

Annotations of Ll_transcript_244971

• Blastp: E3 ubiquitin-protein ligase Topors from Mus with 25.52% of identity
• Blastx: E3 ubiquitin-protein ligase Topors from Mus with 36.23% of identity
• Eggnog: topoisomerase I binding, arginine serine-rich, E3 ubiquitin protein ligase(ENOG410XQZR)
• Kegg: Link to kegg annotations (106021)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437650.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;