Protein coding transcript 164047

• Transcript: Ll_transcript_244754
• CDS coordinates: 255-1175 (+)
• Peptide sequence: MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLAPDEKDGIIPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTNVLKEGGKFIAKIFRGKDTSLLYCQLKLFFPVVTFAKPKSSRNSSIEAFAVCENYSPPEGFNPKDLHRLLEKVGSPSGVEDTDCCSGWLEGPNKVYIPFLACGDLSGYDSDRSYPLPKVAGGTYQSLDPVQPPIAPPYKRALELKKASSQGI*
• ORF Type: complete

Annotations of Ll_transcript_244754

• Blastp: Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase from Homo with 59.33% of identity
• Blastx: Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase from Homo with 59.33% of identity
• Eggnog: Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit (By similarity)(COG0293)
• Kegg: Link to kegg annotations (24140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465097.1)
• Pfam: FtsJ-like methyltransferase (PF01728.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;