Protein coding transcript 164048

• Transcript: Ll_transcript_244763
• CDS coordinates: 218-670 (+)
• Peptide sequence: MANNCYPCAIVLKQGGNFIAKIFRGKDTSLLYCQRHLQFVKTIPLLKDFNIKDLYRLLENVGNPSGVEDTDWCSGWLEGPNKVYIPFLACGDLSGYDSDCSYPLPKVAGGTYQSLDPVQLPIAPPYKRALELKKASSQGIREHENISLDS*
• ORF Type: complete

Annotations of Ll_transcript_244763

• Blastp: Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase from Schizosaccharomyces with 40.77% of identity
• Blastx: Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase from Schizosaccharomyces with 40.77% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC4F10.03c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003545938.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;