Protein coding transcript 164099

• Transcript: Ll_transcript_244545
• CDS coordinates: 112-528 (+)
• Peptide sequence: MGGKGGKGLLAAKTTAAAAYKDKDKDKKRPTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE*
• ORF Type: complete

Annotations of Ll_transcript_244545

• Blastp: Probable histone H2A variant 3 from Oryza sativa with 89.13% of identity
• Blastx: Probable histone H2A variant 3 from Oryza sativa with 93.58% of identity
• Eggnog: histone h2a(COG5262)
• Kegg: Link to kegg annotations (4334071)
• CantataDB: -
• Mirbase: ath-MIR841b (MI0014669)
• Ncbi protein: Link to NCBI protein (XP_004495152.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;