Protein coding transcript 164114

• Transcript: Ll_transcript_244915
• CDS coordinates: 11-568 (+)
• Peptide sequence: MVRDAPISAMLGSHCWLWLAAIITSSFIIFFIIIGLITHYFIFPKDPNTTKIFSSSLRTFINMLVICVSIVIVASAAFLWNEKQNAKKAKKIQNMEGSSPSSLSPDLKNNVADRELESLPQQSLAEATNVHYGARPDLRRLLSEIKGSSVGVLVAGPMKMKQEVAAICSSDLAENLHFESFSFGW*
• ORF Type: complete

Annotations of Ll_transcript_244915

• Blastp: Ferric reduction oxidase 2 from Arabidopsis with 55.19% of identity
• Blastx: Ferric reduction oxidase 2 from Arabidopsis with 54.64% of identity
• Eggnog: NADPH Oxidase(ENOG410XNZY)
• Kegg: Link to kegg annotations (AT1G01580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463880.1)
• Pfam: Ferric reductase NAD binding domain (PF08030.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;