Protein coding transcript 164121

• Transcript: Ll_transcript_246694
• CDS coordinates: 1199-1603 (+)
• Peptide sequence: MSSSSSQSSGYDLSFKILLIGDSAVGKSSLLVSFISNSVEDIAPTIGVDFKIKLLTVGGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSEVWSKEVELYSTNQDCVTVLVGNKVDRVS*
• ORF Type: complete

Annotations of Ll_transcript_246694

• Blastp: Ras-related protein RABC2a from Arabidopsis with 88.81% of identity
• Blastx: Ras-related protein RABC2a from Arabidopsis with 90% of identity
• Eggnog: Ras-related protein(ENOG410XPD0)
• Kegg: Link to kegg annotations (AT5G03530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461021.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;