Transcript | Ll_transcript_246694 |
---|---|
CDS coordinates | 1199-1603 (+) |
Peptide sequence | MSSSSSQSSGYDLSFKILLIGDSAVGKSSLLVSFISNSVEDIAPTIGVDFKIKLLTVGGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSEVWSKEVELYSTNQDCVTVLVGNKVDRVS* |
ORF Type | complete |
Blastp | Ras-related protein RABC2a from Arabidopsis with 88.81% of identity |
---|---|
Blastx | Ras-related protein RABC2a from Arabidopsis with 90% of identity |
Eggnog | Ras-related protein(ENOG410XPD0) |
Kegg | Link to kegg annotations (AT5G03530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461021.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer