Protein coding transcript 164122

• Transcript: Ll_transcript_246695
• CDS coordinates: 240-809 (+)
• Peptide sequence: MSSSSGQSSGYDLSFKILLIGDSAVGKSSLLVSFISNPVEDLAPTIAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSEVWSKELELYSTNQDCVKMLVGNKVDRDSERAVSREEGLALAKELGCLLLECSAKTRQNVESCFQELALKIMEAPSLLEEGSTAAVKRNVLKQKHESQVSQNGGCCS*
• ORF Type: complete

Annotations of Ll_transcript_246695

• Blastp: Ras-related protein RABC2a from Arabidopsis with 74.53% of identity
• Blastx: Ras-related protein RABC2a from Arabidopsis with 74.26% of identity
• Eggnog: Ras-related protein(ENOG410XPD0)
• Kegg: Link to kegg annotations (AT5G03530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455418.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;