Protein coding transcript 164148

• Transcript: Ll_transcript_245802
• CDS coordinates: 2132-2545 (+)
• Peptide sequence: MPPGDLRLCNNCYKQGHIAVECTNEKACNNCRKTGHLARDCPNDPICNLCNVSGHVARQCPKANDLGERFRGGGGGGGIRGGGYRDRDVVCRNCQQLGHMSRDCMVPLMICHNCGGRGHLAYECPSGRMMDRYPRRY*
• ORF Type: complete

Annotations of Ll_transcript_245802

• Blastp: ATP-dependent RNA helicase glh-4 from Caenorhabditis with 35.56% of identity
• Blastx: DNA-binding protein HEXBP from Leishmania with 29.04% of identity
• Eggnog: purine NTP-dependent helicase activity(ENOG410XNTI)
• Kegg: Link to kegg annotations (CELE_T12F5.3)
• CantataDB: Link to cantataDB annotations (CNT0002751)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438188.1)
• Pfam: Zinc knuckle (PF13917.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;