Protein coding transcript 164151

• Transcript: Ll_transcript_245775
• CDS coordinates: 800-1525 (+)
• Peptide sequence: MQVQAVLLLLGGCEAPGSQSVEGPPLDQRGVQEYPKCSQSQRAASLVRFRQKRKERCFDKKVRYIVRQDVALRMQRNKGQFTSAKKQDGSNGWGADQESEQDVQSETSCTHCGISSKSTPMMRKGPSGPRTLCNACGLFWANRVGISPNGLVLVNKYFMSFSIDIYSHLTKAVERWKKEVFCSIFWIFLYIDQKTLFRSPHYSFLYFSRASGFYPWSLLLHHFGAIAACPLAVWTGTLSLE*
• ORF Type: complete

Annotations of Ll_transcript_245775

• Blastp: GATA transcription factor 25 from Arabidopsis with 65.31% of identity
• Blastx: GATA transcription factor 25 from Arabidopsis with 65.31% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT4G24470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438488.1)
• Pfam: Divergent CCT motif (PF09425.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;