Transcript | Ll_transcript_245780 |
---|---|
CDS coordinates | 2032-2445 (+) |
Peptide sequence | MPPGDLRLCNNCYKQGHIAVECTNEKACNNCRKTGHLARDCPNDPICNLCNVSGHVARQCPKANDLGERFRGGGGGGGIRGGGYRDRDVVCRNCQQLGHMSRDCMVPLMICHNCGGRGHLAYECPSGRMMDRYPRRY* |
ORF Type | complete |
Blastp | ATP-dependent RNA helicase glh-4 from Caenorhabditis with 35.56% of identity |
---|---|
Blastx | DNA-binding protein HEXBP from Leishmania with 29.04% of identity |
Eggnog | purine NTP-dependent helicase activity(ENOG410XNTI) |
Kegg | Link to kegg annotations (CELE_T12F5.3) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438188.1) |
Pfam | Zinc knuckle (PF13917.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer