Protein coding transcript 164155

• Transcript: Ll_transcript_245782
• CDS coordinates: 866-1552 (+)
• Peptide sequence: MNLCIWFCVQVQAVLLLLGGREAPSSSQCGEVPPLDQRGALEYPKCSQSQRAASLLRFRQKKKERCFDKKVRYIVRQEVALRMQRSKGQFTSAKKQDGGNGWGADQESVQDAVQSETSCTHCGISSKSTPMMRRGPAGPRTLCNACGLFWANRVGIFTNGLVLVNKSFMSFSVNIYFHLTKAVEIGKKSTGYTQTSLGGSLVKVSLPFFLVSNRKSLFRAHHHSFLYF*
• ORF Type: complete

Annotations of Ll_transcript_245782

• Blastp: GATA transcription factor 25 from Arabidopsis with 61.9% of identity
• Blastx: GATA transcription factor 25 from Arabidopsis with 71.05% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT4G24470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415824.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;