Transcript | Ll_transcript_245783 |
---|---|
CDS coordinates | 242-1219 (+) |
Peptide sequence | MESVNSQQSCEKLMMVPMQIDGSHHAIAKGSSGSGSDEDARVNSFTRTSELTISFEGEVYVFPAVTPQKVQAVLLLLGGQEMPNSAPRSYCSLQQNYHDIGGINDPSQGSKHSRRFASLARFREKRKDRCFEKKIRYTCRKEVAERMHRKNGQFTSLKENYKPPAENCDSSNGTPCPESTERRCQHCGIGEKSTPAMRRGPAGPRSLCNACGLMWANKGTLRDLSKAGRVAFEHNELDTSADIKPSTTEPENSYADQNKEHIIETADTVTNNLSIQVENHDLSVHEQLQDTLEDLADASGTEFEITAGFDENVDIDDSNMRTYWL* |
ORF Type | complete |
Blastp | GATA transcription factor 28 from Arabidopsis with 50.59% of identity |
---|---|
Blastx | GATA transcription factor 28 from Arabidopsis with 50.59% of identity |
Eggnog | Transcription factor(COG5641) |
Kegg | Link to kegg annotations (AT1G51600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420264.1) |
Pfam | tify domain (PF06200.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer