Transcript | Ll_transcript_247185 |
---|---|
CDS coordinates | 222-656 (+) |
Peptide sequence | MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGNYYFQEQLSRHRTLMNIFDKAPSVDKDAFVAPSASVIGDVHIGRGSSIWYGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGNNVTIGQSYFIIIASADMFYP* |
ORF Type | complete |
Blastp | Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 85.07% of identity |
---|---|
Blastx | Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 75.96% of identity |
Eggnog | Transferase(COG0663) |
Kegg | Link to kegg annotations (AT1G19580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416688.1) |
Pfam | Bacterial transferase hexapeptide (six repeats) (PF00132.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer