Protein coding transcript 164360

• Transcript: Ll_transcript_246564
• CDS coordinates: 132-605 (+)
• Peptide sequence: MKNIFSKKPTPKEALRESKREMNNAARGIEREIGALQLEEKKLVLEIKKTAKTGNEAATKILARQLVRLRQQIANLQGSRAQMRGITTHTQAMYAQSSVAVGMKGATKAMAAMNKVACFSYISFLLIIYCYIFLFKLNRDCKILFSFYPQKEKKGMI*
• ORF Type: complete

Annotations of Ll_transcript_246564

• Blastp: Vacuolar protein sorting-associated protein 2 homolog 3 from Arabidopsis with 81.42% of identity
• Blastx: Vacuolar protein sorting-associated protein 2 homolog 3 from Arabidopsis with 81.44% of identity
• Eggnog: Charged multivesicular body protein(COG5491)
• Kegg: Link to kegg annotations (AT1G03950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426723.1)
• Pfam: Snf7 (PF03357.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;