Protein coding transcript 1644

• Transcript: Ll_transcript_510908
• CDS coordinates: 3-317 (+)
• Peptide sequence: VFFLRGEKADITLNTLIFNSFVLCQVFNEINSREMEEVDVFKGIMDNHVFVTVISCTVVFQIIIVEYLGTFANTTPLSLVQWLFCLLVGFMGMPIAARLKQIPV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_510908

• Blastp: Calcium-transporting ATPase 1 from Arabidopsis with 68.27% of identity
• Blastx: Calcium-transporting ATPase 1 from Arabidopsis with 68.27% of identity
• Eggnog: ATPase, Ca transporting, plasma membrane(ENOG410XNNC)
• Kegg: Link to kegg annotations (AT1G27770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432775.1)
• Pfam: Cation transporting ATPase, C-terminus (PF00689.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;