Protein coding transcript 164462

• Transcript: Ll_transcript_244673
• CDS coordinates: 162-1163 (+)
• Peptide sequence: MASSPTKPLLPWKTRFAVYFLSTIFSASRRSDGTVNRRLFDFFDSKIQPNPKPVNGISSSDVVVDPTRNLWFRVFAPSSSDTDAKLPLVVFFHGGGFSFLSPASAAYDGVCRSFCSSFPAVVVSVNYRLTPEHRYPCQYDDGFDVLKFLDENDAVLPKIADVSKCFLAGDSAGGNLAHHVTVRVCQQRLQVVNVIGLISMQPFFGGEERTESEIRIKEAPIVTAAIADWHWKVFLPEGSNRDHEVANVSGPNGVDISGLDYPSTLVFTGGFDPLQDWQKRYYEWLRKCGKEACLIEYPTMIHGFYIFPELPQAAQLISQVKDFIIRQVSNNIK*
• ORF Type: complete

Annotations of Ll_transcript_244673

• Blastp: Probable carboxylesterase 18 from Arabidopsis with 58.26% of identity
• Blastx: Probable carboxylesterase 18 from Arabidopsis with 58.26% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT5G23530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449463.1)
• Pfam: Carboxylesterase family (PF00135.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;