Protein coding transcript 164463

• Transcript: Ll_transcript_244676
• CDS coordinates: 309-713 (+)
• Peptide sequence: MQPFFGGEERTESEIRIKEAPIVTAAIADWHWKVFLPEGSNRDHEVANVSGPNGVDISGLDYPSTLVFTGGFDPLQDWQKRYYEWLRKCGKEACLIEYPTMIHGFYIFPELPQAAQLISQVKDFIIRQVSNNIK*
• ORF Type: complete

Annotations of Ll_transcript_244676

• Blastp: Probable carboxylesterase 18 from Arabidopsis with 61.83% of identity
• Blastx: Probable carboxylesterase 18 from Arabidopsis with 62.14% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT5G23530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449463.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;