Transcript | Ll_transcript_244676 |
---|---|
CDS coordinates | 309-713 (+) |
Peptide sequence | MQPFFGGEERTESEIRIKEAPIVTAAIADWHWKVFLPEGSNRDHEVANVSGPNGVDISGLDYPSTLVFTGGFDPLQDWQKRYYEWLRKCGKEACLIEYPTMIHGFYIFPELPQAAQLISQVKDFIIRQVSNNIK* |
ORF Type | complete |
Blastp | Probable carboxylesterase 18 from Arabidopsis with 61.83% of identity |
---|---|
Blastx | Probable carboxylesterase 18 from Arabidopsis with 62.14% of identity |
Eggnog | alpha beta hydrolase fold-3 domain protein(COG0657) |
Kegg | Link to kegg annotations (AT5G23530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449463.1) |
Pfam | alpha/beta hydrolase fold (PF07859.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer