Protein coding transcript 1645

• Transcript: Ll_transcript_510907
• CDS coordinates: 3-350 (+)
• Peptide sequence: CYELIHMDIWGPFSIPSIHGHKYFLTIIDDCSRFTWVYLMKSKSETFELLQNFIAMIETQFCSIIKSIRSDNGPEFTIESVYSSKGILHQTSCTYTPQQNGVVERKHQYLLNVARA
• ORF Type: internal

Annotations of Ll_transcript_510907

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.88% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004498431.2)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;