Transcript | Ll_transcript_245601 |
---|---|
CDS coordinates | 311-1210 (+) |
Peptide sequence | MAPNLNLNLFYVPVLFLLFGFLVKVESEHDIIGGLENSLSKVSVSTVALFTLAMAAATGLGAVPFFFVELDPQWAGLCNGMAAGVMLAASFDLIQEGQEYGSGNWVVIGILAGAIFICLCKKCLEQYGEVSMLDIKGADAAKVVLVIGIMTLHSFGEGSGVGVSFAGSKGFSQGLLVTLAIAVHNIPEGLAVSMVLASRGVSPQNAMLWSIITSLPQPIVAVPSFMCADAFSKFLPFCTGFAAGCMIWMVVAEVLPDAFKEASASQVASAATLSVAFMEALSTLFQNFNHDYNSDDASGF |
ORF Type | 3prime_partial |
Blastp | Putative zinc transporter At3g08650 from Arabidopsis with 88.04% of identity |
---|---|
Blastx | Putative zinc transporter At3g08650 from Arabidopsis with 88.04% of identity |
Eggnog | zinc transporter(COG0428) |
Kegg | Link to kegg annotations (AT3G08650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003623650.1) |
Pfam | ZIP Zinc transporter (PF02535.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer