Protein coding transcript 16466

• Transcript: Ll_transcript_276574
• CDS coordinates: 1107-1412 (+)
• Peptide sequence: MMENSSSSPSSSPLILCCLIINTDTVIEKSGPERTSPTGPSSGHCCQSFIPFVNIEFTPPSLPTITSEYCPSNDLRVENVSAAFARCFSVYAIRPPTICFS*
• ORF Type: complete

Annotations of Ll_transcript_276574

• Blastp: Cation/H(+) antiporter 28 from Arabidopsis with 48.66% of identity
• Blastx: Cation/H(+) antiporter 28 from Arabidopsis with 55.98% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT3G52080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450839.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;