Protein coding transcript 164677

• Transcript: Ll_transcript_247121
• CDS coordinates: 161-508 (+)
• Peptide sequence: MMILSRVLKRVDQVGMSMMKMNLILKDGKFLFLSLFNIIRIPFNVIISYVHFMANFTIIFRKVEGDSEGISAPGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR*
• ORF Type: complete

Annotations of Ll_transcript_247121

• Blastp: WRKY transcription factor WRKY24 from Oryza sativa with 90.38% of identity
• Blastx: WRKY transcription factor WRKY24 from Oryza sativa with 87.04% of identity
• Eggnog: WRKY transcription factor(ENOG4112BTF)
• Kegg: Link to kegg annotations (4327518)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461176.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;