Transcript | Ll_transcript_276581 |
---|---|
CDS coordinates | 1107-1412 (+) |
Peptide sequence | MMENSSSSPSSSPLILCCLIINTDTVIEKSGPERTSPTGPSSGHCCQSFIPFVNIEFTPPSLPTITSEYCPSNDLRVENVSAAFARCFSVYAIRPPTICFS* |
ORF Type | complete |
Blastp | Cation/H(+) antiporter 28 from Arabidopsis with 62.61% of identity |
---|---|
Blastx | Cation/H(+) antiporter 28 from Arabidopsis with 55.98% of identity |
Eggnog | Sodium hydrogen exchanger(COG0475) |
Kegg | Link to kegg annotations (AT3G52080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450839.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer