Protein coding transcript 164690

• Transcript: Ll_transcript_245714
• CDS coordinates: 1257-1658 (+)
• Peptide sequence: MALMMSGDLGVSAFPEEDNIFCWKGTISGSKDTVFEGTLYKLSLSFPNDYPFKPPKVKFETTCFHPNVDMNGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNPEAAQLWSNQTGIKLAHALFYGW*
• ORF Type: complete

Annotations of Ll_transcript_245714

• Blastp: Ubiquitin-conjugating enzyme E2 19 from Arabidopsis with 86.67% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 19 from Arabidopsis with 87.3% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG4111IGV)
• Kegg: Link to kegg annotations (AT3G20060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423367.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;