Transcript | Ll_transcript_246531 |
---|---|
CDS coordinates | 313-717 (+) |
Peptide sequence | MVSFEMDDRKKIGLGLTGFGVFFSFLGIVFFFDKGLLAMGNILFVSGVSLTIGLKSTMQFFMKRSNFKGTISFGIGFLILIIGWPILGMIIEAYGFIVLFSGFWPTLSVFIQKVPVLGWLFQQPFVRSVCIYSL* |
ORF Type | complete |
Blastp | Vesicle transport protein GOT1 from Arabidopsis with 69.23% of identity |
---|---|
Blastx | Vesicle transport protein GOT1 from Arabidopsis with 69.23% of identity |
Eggnog | golgi transport(COG5120) |
Kegg | Link to kegg annotations (AT3G03180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455937.1) |
Pfam | Got1/Sft2-like family (PF04178.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer