Protein coding transcript 164721

• Transcript: Ll_transcript_246510
• CDS coordinates: 785-1207 (+)
• Peptide sequence: MVSFEMDDRKKIGLGLTGFGVFFSFLGIVFFFDKGLLAMGNILFVSGVSLTIGLKSTMQFFMKRSNFKGTISFGIGFLILIIGWPILGMIIEAYGFIVLFSGFWPTLSVFIQKVPVLGWLFQQPFVRSLFDRYRGRRVPV*
• ORF Type: complete

Annotations of Ll_transcript_246510

• Blastp: Vesicle transport protein GOT1 from Arabidopsis with 72.14% of identity
• Blastx: Vesicle transport protein GOT1 from Arabidopsis with 72.14% of identity
• Eggnog: golgi transport(COG5120)
• Kegg: Link to kegg annotations (AT3G03180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445919.1)
• Pfam: Got1/Sft2-like family (PF04178.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;