Protein coding transcript 164732

• Transcript: Ll_transcript_246517
• CDS coordinates: 1368-1703 (+)
• Peptide sequence: MLQLVKWLSELCLLGVSKYSPFTYGFSTMPFFHALTYCFLASSSLYSIVFILYGIVPQLCFFKGIPVFPKVTDPWFAVFAFLYIATQIQHLIEVLSGGGSITMWWDEQRIWI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_246517

• Blastp: Cellulose synthase-like protein G2 from Arabidopsis with 35.45% of identity
• Blastx: Cellulose synthase-like protein G2 from Arabidopsis with 36.25% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT4G24000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412953.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;