Protein coding transcript 164734

• Transcript: Ll_transcript_246520
• CDS coordinates: 1644-2321 (+)
• Peptide sequence: MLQLVKWLSELCLLGVSKYSPFTYGFSTMPFFHALTYCFLASSSLYSIVFILYGIVPQLCFFKGIPVFPKVTDPWFAVFAFLYIATQIQHLIEVLSGGGSITMWWDEQRIWILKSVTSLFAITEAIKKWLGLNKKKFSLSNKAIDKENLKKYEQGRFNFQGAALYMSPMVVLLIVNIVCFFGGLWRLVKVKDFEDMFGQLFLLSYVIVLSYPILEAIVTMKSKSG*
• ORF Type: complete

Annotations of Ll_transcript_246520

• Blastp: Cellulose synthase-like protein G1 from Arabidopsis with 34.08% of identity
• Blastx: Cellulose synthase-like protein G1 from Arabidopsis with 35.16% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT4G24010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412953.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;