Protein coding transcript 16476

• Transcript: Ll_transcript_276584
• CDS coordinates: 2-451 (+)
• Peptide sequence: EALAYASRIARHPGVKLTIIRFLVDPNAESSRLVGYRVILEEQQKEMKLDDEYFAQFYEKHVVGGYMSYTEKHLANAAETFSTLRSFEGQYSLVIVGREGGLNSILTKGMNDWQQCPELGPIGDVLSGPDFSMTVSVLIIQQHKIKGDLD
• ORF Type: internal

Annotations of Ll_transcript_276584

• Blastp: Cation/H(+) antiporter 28 from Arabidopsis with 58.06% of identity
• Blastx: Cation/H(+) antiporter 28 from Arabidopsis with 58.06% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT3G52080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441111.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;