Protein coding transcript 164847

• Transcript: Ll_transcript_246908
• CDS coordinates: 2-391 (-)
• Peptide sequence: CKEFDEFGISFKSKPGALPFIVLLDRGNCFFALKVWNAQKAGASAVLVADDIDENLITMDTPEEDGSAAKYIENITIPSALVEKSFGEKLKNAIRGGDMVNVNLDWREAVPHPDARVEYELWTNSNDECG
• ORF Type: internal

Annotations of Ll_transcript_246908

• Blastp: Vacuolar-sorting receptor 4 from Arabidopsis with 84.62% of identity
• Blastx: Vacuolar-sorting receptor 4 from Arabidopsis with 84.62% of identity
• Eggnog: calcium ion binding(ENOG41105IF)
• Kegg: Link to kegg annotations (AT2G14720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426566.1)
• Pfam: PA domain (PF02225.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;