Protein coding transcript 1649

• Transcript: Ll_transcript_510837
• CDS coordinates: 30-1025 (+)
• Peptide sequence: MEKIPYTCRCVLSFDRIAAVLVKKKCCSCLFSHYLCLELSHIHVTFDSQIIITQNYLRHLRMGEKYKTLVIEQKNPNSRVFYLYLNNPKQRNALTRDFFSEFPKALHALDHNPDVSVIILTAVGDHFCSGIELSALNSTATDAPSGESLRRNILAMQDSITALERCRKPVIASIQGACIGGAIDIITACDIRYCSKDAFFSVKEVDLALAADLGSLQRLPSIVGFGNAMELALTARRFSGLEAKELGLVSRAFDSKDELHEGVLNIAQAIAAKSPLAVVGTKTVLLKSRDLTVDQGLDYVATMNSARLFSSDLTEAVAAHTQKRKPVYSKL*
• ORF Type: complete

Annotations of Ll_transcript_510837

• Blastp: Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal from Arabidopsis with 66.18% of identity
• Blastx: Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal from Arabidopsis with 66.18% of identity
• Eggnog: Enoyl-CoA hydratase(ENOG410XTHX)
• Kegg: Link to kegg annotations (AT5G43280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453051.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF00378.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;