Protein coding transcript 164910

• Transcript: Ll_transcript_244628
• CDS coordinates: 2-604 (+)
• Peptide sequence: LKHRNKHHCYHQHNQTHFFSISLSLSHSPRFRVSSATVSSSQMATTFSGLQFALSRPCIPSTQRFADAGTMVLGGKSKVGAWNNLTSASHVASVQPLRQSLTSSSIKSVKTVTKAMSESSADTPVSGLPINLKGKRAFIAGVADDHGYGWAIAKSLAAAGAEILVGTWVPVSYLFFLEKTYMSGNIRNHWVLSTDFLTPVF
• ORF Type: internal

Annotations of Ll_transcript_244628

• Blastp: Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic from Arabidopsis with 50.38% of identity
• Blastx: Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic from Arabidopsis with 47.33% of identity
• Eggnog: Enoyl- acyl-carrier-protein reductase NADH(COG0623)
• Kegg: Link to kegg annotations (AT2G05990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450932.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;