Transcript | Ll_transcript_247046 |
---|---|
CDS coordinates | 39-839 (+) |
Peptide sequence | MLRVLNSSAALRFIPSCASRFSVRSMSSSSSFNKVQIQRDHTTFDAYVVGKEDAPGIVVLQEWWGVDFEIKNHAVTISQLGSGFKALIPDLYRGKVGLDVAEAQHLMDGLDWQGAVQDIRASINWLKANGSKKAGVTGFCMGGALSIASSVLVPEVDAVVAFYGVPSSELADPAQAKAPIQAHFGEHDNFVGFSDVTAAKSLEEKLKPSGVPHEVHLYPGNGHAFMNRSPEGINRRKSMGLADEDEAAVQLAWSRFESWMTQYLSS* |
ORF Type | complete |
Blastp | Protein usf from Aquifex with 30.58% of identity |
---|---|
Blastx | Protein usf from Aquifex with 30.58% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464901.1) |
Pfam | Dienelactone hydrolase family (PF01738.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer