Protein coding transcript 164920

• Transcript: Ll_transcript_247054
• CDS coordinates: 39-740 (+)
• Peptide sequence: MLRVLNSSAALRFIPSCASRFSVRSMSSSSSFNKVQIQRDHTTFDAYVVGKEDAPGIVVLQEWWGVDFEIKNHAVTISQLGSGFKALIPDLYRGKVGLDVAEAQHLMDGLDWQGAVQDIRASINWLKANGSKKAGVTGFCMGGALSIASSVLVPEVDAVVAFYGVPSSELADPAQAKAPIQAHFGEHDNFVGFSDVTVRKYICKTYCLSFLSLKTPCGQVIHNFINLAAKFFK*
• ORF Type: complete

Annotations of Ll_transcript_247054

• Blastp: Protein usf from Aquifex with 32.95% of identity
• Blastx: Protein usf from Aquifex with 32.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464901.1)
• Pfam: Dienelactone hydrolase family (PF01738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;