Protein coding transcript 164981

• Transcript: Ll_transcript_246293
• CDS coordinates: 194-649 (+)
• Peptide sequence: MVKSNSCFKLIVCGANSAEKDGYQELDTEIKDSNDKRGWSFQKRSERHHVLSNIVITETPSSVNKESSECTSISCQPRAESNVVEKIYTSNFSDEKLQLSSLASSQMSETIVTETESEVAVNKPESVVIIIQAAIRGFLLILVSFRLKENF*
• ORF Type: complete

Annotations of Ll_transcript_246293

• Blastp: Protein IQ-DOMAIN 32 from Arabidopsis with 35.11% of identity
• Blastx: -
• Eggnog: IQ-domain(ENOG410Y9MX)
• Kegg: Link to kegg annotations (AT1G19870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458503.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;