Transcript | Ll_transcript_246293 |
---|---|
CDS coordinates | 194-649 (+) |
Peptide sequence | MVKSNSCFKLIVCGANSAEKDGYQELDTEIKDSNDKRGWSFQKRSERHHVLSNIVITETPSSVNKESSECTSISCQPRAESNVVEKIYTSNFSDEKLQLSSLASSQMSETIVTETESEVAVNKPESVVIIIQAAIRGFLLILVSFRLKENF* |
ORF Type | complete |
Blastp | Protein IQ-DOMAIN 32 from Arabidopsis with 35.11% of identity |
---|---|
Blastx | - |
Eggnog | IQ-domain(ENOG410Y9MX) |
Kegg | Link to kegg annotations (AT1G19870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458503.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer