Protein coding transcript 165013

• Transcript: Ll_transcript_246977
• CDS coordinates: 987-1430 (+)
• Peptide sequence: MFKVLHKSPDIPETLSSEGQDFLRQCFRRNPAERPSATMLLTHAFVQNLHDQDVLAHSQGYPRADPGPEVHFRSPDCSPKKGPDVAPLDYSPKKGRDVATLDCSPKKGRDVASLSASIGARIINKIHNFIGDTSKKYTTEKASHTHC*
• ORF Type: complete

Annotations of Ll_transcript_246977

• Blastp: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 66.67% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 68.18% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT5G66850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416747.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;