Protein coding transcript 165091

• Transcript: Ll_transcript_247026
• CDS coordinates: 33-338 (+)
• Peptide sequence: MVDIDIFRDEIQRIKAVNPDITHREAFSAAAKNWAHFPHIHFGLMPDHQPVKKANIHQVNENPSYFLTSFSLNEKKTLISMVLFLIPNNVFCGCRKQKTCF*
• ORF Type: complete

Annotations of Ll_transcript_247026

• Blastp: Axial regulator YABBY 3 from Arabidopsis with 80.77% of identity
• Blastx: Axial regulator YABBY 1 from Arabidopsis with 80.77% of identity
• Eggnog: cell differentiation(ENOG41104RE)
• Kegg: Link to kegg annotations (AT4G00180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447099.1)
• Pfam: YABBY protein (PF04690.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;