Protein coding transcript 165092

• Transcript: Ll_transcript_247027
• CDS coordinates: 252-689 (+)
• Peptide sequence: MSSSSTTLSLDHLPLSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSPNQFHLGYSFISPTHNLLEEMPNPSPNLFMNQNANMAHDFSMPPKTTVDELPRPPITNRPPEKRQRVPSAYNRFIKDEIQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_247027

• Blastp: Protein YABBY 4 from Oryza sativa with 54.17% of identity
• Blastx: Protein YABBY 4 from Oryza sativa with 55.06% of identity
• Eggnog: axial regulator YABBY(ENOG410YG5N)
• Kegg: Link to kegg annotations (4330130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446686.1)
• Pfam: YABBY protein (PF04690.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;