Protein coding transcript 165096

• Transcript: Ll_transcript_247013
• CDS coordinates: 197-661 (+)
• Peptide sequence: MSASSTSFSPDQQLQQQQLSPSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPPTNQLHVGHNFFTPQNLMEEIRNAPSTNMMMNQLPNQNDLVMNTMRGGPEEIPKPPPPNRPPEKRQRVPSAYNRFIKDEIQRIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_247013

• Blastp: Axial regulator YABBY 1 from Arabidopsis with 65.73% of identity
• Blastx: Axial regulator YABBY 1 from Arabidopsis with 65.93% of identity
• Eggnog: axial regulator YABBY(ENOG410YG5N)
• Kegg: Link to kegg annotations (AT2G45190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462601.1)
• Pfam: YABBY protein (PF04690.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;