Protein coding transcript 165205

• Transcript: Ll_transcript_128973
• CDS coordinates: 175-618 (+)
• Peptide sequence: MACYAPSLITSNPNSFFSPKPLSSTFPLSSLSFSSLPLRSIPLRTSLSPRSSFLLRATTSSEFPLVGNTAPDFEAEAVFDQEFINVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEELNTEILGVSVDSVFSPCMGSN*
• ORF Type: complete

Annotations of Ll_transcript_128973

• Blastp: 2-Cys peroxiredoxin BAS1, chloroplastic from Hordeum with 84.44% of identity
• Blastx: 2-Cys peroxiredoxin BAS1, chloroplastic from Hordeum with 85.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444263.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;