Protein coding transcript 16522

• Transcript: Ll_transcript_276670
• CDS coordinates: 1474-1824 (+)
• Peptide sequence: MLCMEFISSDDYHCRDGFFFAVKEVSLLDQGSQGKQSVYQLEQEIALLSQFEHENIVQYYDTEMDESKLYIFLELVTKGSLASLYRRYTLRDSQVSAYTRQILHGLKYLHDRNVVHR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276670

• Blastp: Mitogen-activated protein kinase kinase kinase 9 from Arabidopsis with 40% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 1 from Arabidopsis with 69.61% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT4G08480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415277.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;