Protein coding transcript 165276

• Transcript: Ll_transcript_128071
• CDS coordinates: 48-572 (+)
• Peptide sequence: MGQALGCYQVDQSNVAIKEHFGKFDDVLQPGCHCLPWCLGYQIAGGLSLRVQQLDVRCETKTKDNVFVTVVASVQYRAVAEKASDAFYRLTNTREQIQSYVFDVIRASVPKLELDSVFEQKNDIAKSVEDELEKVFIVLMFCTILFYLFLICMKSYLSLSVKVVMVHINNLIQR*
• ORF Type: complete

Annotations of Ll_transcript_128071

• Blastp: Hypersensitive-induced response protein 2 from Arabidopsis with 84.56% of identity
• Blastx: Hypersensitive-induced response protein-like protein 1 from Oryza sativa with 86.84% of identity
• Eggnog: Band 7 protein(COG0330)
• Kegg: Link to kegg annotations (AT1G69840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014516949.1)
• Pfam: SPFH domain / Band 7 family (PF01145.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;