Protein coding transcript 165286

• Transcript: Ll_transcript_128087
• CDS coordinates: 504-827 (+)
• Peptide sequence: MDPEEVNLNRENGKSSDGFVDRSKVRILLCDNDSKSSQEVFTLLLGCSYQVTAVRSARQVIDALNAEGQHIDIILAELDLPMKKGMKMLKYITRDKELRRIPVISKL*
• ORF Type: complete

Annotations of Ll_transcript_128087

• Blastp: Two-component response regulator-like APRR1 from Arabidopsis with 78.79% of identity
• Blastx: Two-component response regulator-like APRR1 from Arabidopsis with 65.91% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT5G61380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417277.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;