Transcript | Ll_transcript_127605 |
---|---|
CDS coordinates | 3-419 (+) |
Peptide sequence | AQKQTPKQPVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTADAAARAYDRAAIKFRGVDADINFNLTDYDDDLKQMKNLSKEEFVHILRRQSTGFSRGISKYRGVTLHKCGRWEARMGQFLGKK* |
ORF Type | 5prime_partial |
Blastp | Floral homeotic protein APETALA 2 from Arabidopsis with 91.73% of identity |
---|---|
Blastx | Floral homeotic protein APETALA 2 from Arabidopsis with 91.73% of identity |
Eggnog | floral homeotic protein APETALA(ENOG410YBZ8) |
Kegg | Link to kegg annotations (AT4G36920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458636.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer