Protein coding transcript 165342

• Transcript: Ll_transcript_127628
• CDS coordinates: 3-533 (+)
• Peptide sequence: AQKQTPKQPVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGVDADINFNLIDYDDDLKPLKNLSKEEFVQTLRRQTTGFSRGSSKYRGVTLQNCGRSEAPTGQFHGKMAYDKAAIKCNGREAVTNIEPCKYESDMKPKAINEGSSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_127628

• Blastp: Floral homeotic protein APETALA 2 from Arabidopsis with 72.63% of identity
• Blastx: Ethylene-responsive transcription factor RAP2-7 from Arabidopsis with 61.11% of identity
• Eggnog: floral homeotic protein APETALA(ENOG410YBZ8)
• Kegg: Link to kegg annotations (AT4G36920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447915.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;