Protein coding transcript 165350

• Transcript: Ll_transcript_127597
• CDS coordinates: 3-326 (+)
• Peptide sequence: AQKQTPKQPVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGVDADINFNLIDYDDDLKPVGNLIRFLMNMNIDGLCE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_127597

• Blastp: AP2-like ethylene-responsive transcription factor TOE2 from Arabidopsis with 84.44% of identity
• Blastx: Floral homeotic protein APETALA 2 from Arabidopsis with 88.89% of identity
• Eggnog: AP2(ENOG4110426)
• Kegg: Link to kegg annotations (AT5G60120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447915.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;