Protein coding transcript 165363

• Transcript: Ll_transcript_128000
• CDS coordinates: 183-572 (+)
• Peptide sequence: MEDNLDSVPCSSLAVESSIRVSAAGAIWGLCLGPHQANQRGLKGMDKALFVANATGRFGLKCGFIAGVFSVTRCGLQKYRGRQDWVNGFIAGGITGAAVAAGTRNWSQVIGMAGIVSVLCGAADYVRPA*
• ORF Type: complete

Annotations of Ll_transcript_128000

• Blastp: Outer envelope pore protein 16-4, chloroplastic from Arabidopsis with 54.76% of identity
• Blastx: Outer envelope pore protein 16-4, chloroplastic from Arabidopsis with 54.76% of identity
• Eggnog: Tim17/Tim22/Tim23/Pmp24 family(ENOG410YVII)
• Kegg: Link to kegg annotations (AT3G62880)
• CantataDB: Link to cantataDB annotations (CNT0002558)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441335.1)
• Pfam: Tim17/Tim22/Tim23/Pmp24 family (PF02466.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;