Transcript | Ll_transcript_276777 |
---|---|
CDS coordinates | 266-766 (+) |
Peptide sequence | MTTAARPTWAPAKGGNEQGGTRIFGPSQKYSSRDIASHTTLKPRKEGQDTNEELKKRNLRDELEDRERKHFSTKNKSYSDDRDYGKGSHLLLEGPRRDFEDRIVPRNVDADDSDIEVKSDDESDDDDDDEDDTEALLAELEQIKKERAEEKLRKVNLFTYLSRPAI* |
ORF Type | complete |
Blastp | Protein CWC15 homolog from Caenorhabditis with 46.36% of identity |
---|---|
Blastx | Protein CWC15 homolog B from Xenopus with 50% of identity |
Eggnog | Protein CWC15 homolog(ENOG410Z258) |
Kegg | Link to kegg annotations (CELE_T10C6.5) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446099.1) |
Pfam | Cwf15/Cwc15 cell cycle control protein (PF04889.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer