Transcript | Ll_transcript_276778 |
---|---|
CDS coordinates | 266-952 (+) |
Peptide sequence | MTTAARPTWAPAKGGNEQGGTRIFGPSQKYSSRDIASHTTLKPRKEGQDTNEELKRRNLRDELEDRERRHFLTKNKSYNDDRDHVKGSHLLLEGSRRDIEDRIVARNVDADDSDVEVKSDDESDDDDSDDDDTEALLAELEQIKKERAEEKMRKERQEQEEELKVKEAELLKGNPLLNNPTSFNVKRRWDDDVVFKNQARGENKVAKRFINDTIRNDFHRKFLHRYMK* |
ORF Type | complete |
Blastp | Protein CWC15 homolog A from Xenopus with 48.95% of identity |
---|---|
Blastx | Pre-mRNA-splicing factor cwc15 from Aspergillus with 66.67% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (414727) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446099.1) |
Pfam | Cwf15/Cwc15 cell cycle control protein (PF04889.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer